CDS

Accession Number TCMCG068C37145
gbkey CDS
Protein Id KAG5605016.1
Location complement(join(13203132..13203278,13205252..13205557))
Organism Solanum commersonii
locus_tag H5410_026508

Protein

Length 150aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA655804, BioSample:SAMN15755581
db_source JACXVP010000005.1
Definition hypothetical protein H5410_026508 [Solanum commersonii]
Locus_tag H5410_026508

EGGNOG-MAPPER Annotation

COG_category L
Description Introduces a single-strand break via transesterification at a target site in duplex DNA. Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(5'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 3'-OH DNA strand
KEGG_TC -
KEGG_Module M00414        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
ko03032        [VIEW IN KEGG]
ko03400        [VIEW IN KEGG]
KEGG_ko ko:K03165        [VIEW IN KEGG]
EC 5.99.1.2        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko03440        [VIEW IN KEGG]
ko03460        [VIEW IN KEGG]
map03440        [VIEW IN KEGG]
map03460        [VIEW IN KEGG]
GOs GO:0000003        [VIEW IN EMBL-EBI]
GO:0000278        [VIEW IN EMBL-EBI]
GO:0000280        [VIEW IN EMBL-EBI]
GO:0000712        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003676        [VIEW IN EMBL-EBI]
GO:0003677        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0003916        [VIEW IN EMBL-EBI]
GO:0003917        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005634        [VIEW IN EMBL-EBI]
GO:0005654        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006259        [VIEW IN EMBL-EBI]
GO:0006260        [VIEW IN EMBL-EBI]
GO:0006265        [VIEW IN EMBL-EBI]
GO:0006281        [VIEW IN EMBL-EBI]
GO:0006310        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0006950        [VIEW IN EMBL-EBI]
GO:0006974        [VIEW IN EMBL-EBI]
GO:0006996        [VIEW IN EMBL-EBI]
GO:0007049        [VIEW IN EMBL-EBI]
GO:0007059        [VIEW IN EMBL-EBI]
GO:0007127        [VIEW IN EMBL-EBI]
GO:0007131        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009059        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016043        [VIEW IN EMBL-EBI]
GO:0016604        [VIEW IN EMBL-EBI]
GO:0016605        [VIEW IN EMBL-EBI]
GO:0016853        [VIEW IN EMBL-EBI]
GO:0022402        [VIEW IN EMBL-EBI]
GO:0022414        [VIEW IN EMBL-EBI]
GO:0031974        [VIEW IN EMBL-EBI]
GO:0031981        [VIEW IN EMBL-EBI]
GO:0033554        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0034645        [VIEW IN EMBL-EBI]
GO:0035825        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043233        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044428        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044451        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045132        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0048285        [VIEW IN EMBL-EBI]
GO:0050896        [VIEW IN EMBL-EBI]
GO:0051276        [VIEW IN EMBL-EBI]
GO:0051304        [VIEW IN EMBL-EBI]
GO:0051307        [VIEW IN EMBL-EBI]
GO:0051321        [VIEW IN EMBL-EBI]
GO:0051716        [VIEW IN EMBL-EBI]
GO:0061982        [VIEW IN EMBL-EBI]
GO:0070013        [VIEW IN EMBL-EBI]
GO:0071103        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0071840        [VIEW IN EMBL-EBI]
GO:0090304        [VIEW IN EMBL-EBI]
GO:0097159        [VIEW IN EMBL-EBI]
GO:0098813        [VIEW IN EMBL-EBI]
GO:0140013        [VIEW IN EMBL-EBI]
GO:0140097        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901363        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]
GO:1903046        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCCGGAGGCGGAGGACGGGTGATAAGGGTACTAAATGTGGCTGAAAAGCCGTCGGTGGCCAAGGCAGTGTCGGGGATACTATCGAAGAACCAACCAGGTGGCATGAGAGTAAGAGACGGACGTTCCAGGTACAACAAAATCTTTGAGTTCAACTACACCATTCGGAACCAGCCTTGCCAGATGCTGTTCACATCCGTCACGGGCCATCTCATGGAGCTTGAGTTTGACGAGCGTTACCGGAAATGGCACTCGTGTGATCCGCTCGACCTCTATAATGCGCCTGTTCGGAAGTTTGTCCCTGAGGTTGGTAATGGAAGAGATACAAGGTTCTGGCTAGATGAATGGATAGGGCTTACTCCACCAATGTCTTCGTTTCAGAACCTCTATGCCTTCACCTTAAATACTGGTAGTTGGTTTCAGATTGCTGGATTAGAAGTAACTGGTGTCTGA
Protein:  
MAGGGGRVIRVLNVAEKPSVAKAVSGILSKNQPGGMRVRDGRSRYNKIFEFNYTIRNQPCQMLFTSVTGHLMELEFDERYRKWHSCDPLDLYNAPVRKFVPEVGNGRDTRFWLDEWIGLTPPMSSFQNLYAFTLNTGSWFQIAGLEVTGV